Search Ontology:
ChEBI
peptide YY
- Term ID
- CHEBI:80330
- Synonyms
-
- peptide tyrosine tyrosine
- PYY (3-36)
- PYY 3-36
- PYY3-36
- Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
- YPIKPEAPGEDASPEELNYYASLRHYLNLVTRQRY-NH2
- Definition
- A 36-membered human gut polypeptide consisting of Tyr, Pro, Ile, Lys, Pro, Glu, Ala, Pro, Gly, Glu, Asp, Ala, Ser, Pro, Glu, Glu, Leu, Asn, Arg, Tyr, Tyr, Ala, Ser, Leu, Arg, His, Tyr, Leu, Asn, Leu, Val, Thr, Arg, Gln, Arg and Tyr-NH2 residues joined in sequence.
- References
-
- CAS:1366182-03-7
- KEGG:C16118
- PMID:25098834
- PMID:25372381
- PMID:25527432
- PMID:25658456
- PMID:25870965
- PMID:26006332
- PMID:26330345
- PMID:26676513
- PMID:26774588
- PMID:27027248
- PMID:27207785
- PMID:27264721
- PMID:27434221
- PMID:27465830
- PMID:27670407
- PMID:28003328
- PMID:28040488
- PMID:28106168
- PMID:28485050
- PMID:28626523
- PMID:28666375
- PMID:28684122
- PMID:28684238
- PMID:28735851
- Reaxys:9754261
- Wikipedia:Peptide_YY
- Ontology
- ChEBI ( EBI )
- is a type of
-
- has_role
-
Phenotype
Phenotype resulting from peptide YY
Phenotype where environments contain peptide YY
Phenotype modified by environments containing peptide YY
Human Disease Model