| ZFIN ID: ZDB-EXP-190918-4 |
Experiment Conditions Description: chemical treatment: corticotropin
| chemical treatment: corticotropin |
|---|
| Name: | chemical treatment |
|---|---|
| Synonyms: | |
| Definition: | Experimental condition in which the fish is treated with a chemical substance. This treatment could be administered by adding the chemical substance to the tank water, injections, or by consumption. |
| Ontology: | Zebrafish Environment Condition Ontology [ZECO:0000111] |
| Name: | corticotropin |
|---|---|
| Synonyms: | ACTH, Adrenocorticotropic hormone, adrenocorticotropin, corticotrofina, corticotrophine, corticotrophinum, Corticotropin, cortrophin, L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-alpha-aspartylglycyl-L-a, SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF |
| Definition: | A polypeptide hormone produced and secreted by the pituitary gland comprising 39 amino acid residues coupled in a linear sequence. The N-terminal 24-amino acid segment is identical in all species and contains the adrenocorticotrophic activity. Corticotropin stimulates the cortex of the adrenal gland and boosts the synthesis of corticosteroids, mainly glucocorticoids but also sex steroids (androgens). It is used in the treatment of certain neurological disorders such as infantile spasms and multiple sclerosis, and diagnostically to investigate adrenocortical insufficiency. |
| Ontology: | ChEBI [CHEBI:3892] ( EBI ) |
| Publication: | Lee et al., 2018 |
|---|