Term Name: desirudin
Synonyms: 63-desulfohirudin (Hirudo medicinalis isoform HV1), CGP 39393, CGP-39393, desirudin, desirudin recombinant, desirudina, desirudine, desirudinum, desulfatohirudin, desulphatohirudin, desulphatohirudin HV1, IK-HIR02, Iprivask, L-valyl-L-valyl-L-tyrosyl-L-threonyl-L-alpha-aspartyl-L-cysteinyl-L-threonyl-L-alpha-glutamyl-L-seryl-glycyl-L-glutaminyl-L-asparagyl-L-leucyl-L-cysteinyl-L-leucyl-L-cysteinyl-L-alpha-glutamyl-glycyl-L-seryl-L-asparagyl-L-valyl-L-cysteinyl-glycyl-L-glutam, Revasc, VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ, VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ (disulfide bridge: 6->14; 16->28; 22->39)
Definition: A heterodetic cyclic peptide composed of 65 amino acids joined in sequence and cyclised by three disulfide bridges between cysteine residues 6-14, 16-28 and 22-39. It is a highly specific inhibitor of thrombin and used as an anticoagulant in patients to prevent venous thromboembolism. Its amino acid sequence differs from natural hirudin by lack of sulfate group on Tyr-63.
Ontology: ChEBI [CHEBI:140427]  ( EBI )

Relationships
is a type of: heterodetic cyclic peptide organic disulfide polypeptide
has_role: anticoagulant EC 3.4.21.5 (thrombin) inhibitor